Project name: 1jbf

Status: done

submitted: 2025-12-12 13:29:42, status changed: 2025-12-12 17:02:50

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence NLPRCTEGPWGWVCM
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.8289 4.37494 27.2441 113
cluster_2.pdb ( medoid) 23.5912 6.99413 27.375 165
cluster_3.pdb ( medoid) 14.7655 6.9757 25.5557 103
cluster_4.pdb ( medoid) 14.5423 10.5898 28.0939 154
cluster_5.pdb ( medoid) 9.98765 11.2138 30.6572 112
cluster_6.pdb ( medoid) 6.63561 13.7139 28.4973 91
cluster_7.pdb ( medoid) 6.19086 10.6609 22.9517 66
cluster_8.pdb ( medoid) 4.98741 14.8374 30.8127 74
cluster_9.pdb ( medoid) 4.72587 11.6381 26.297 55
cluster_10.pdb ( medoid) 4.60933 14.5357 31.5923 67