CABS-dock: 1d4aed0a15f9139

Project name: 1d4aed0a15f9139

Status: done

submitted: 2026-01-12 07:53:34, status changed: 2026-01-12 10:20:25

Project settings

Protein sequence(s)	PTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVMLERLTLPPSEITLL input pdb
Peptide sequence	ERLTLPPSEITLL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.7151	4.83491	25.1416	134
cluster_2.pdb ( medoid)	27.5478	4.97317	23.2681	137
cluster_3.pdb ( medoid)	23.1866	6.51238	23.9409	151
cluster_4.pdb ( medoid)	19.0701	7.65594	20.7049	146
cluster_5.pdb ( medoid)	11.3919	9.74373	27.1181	111
cluster_6.pdb ( medoid)	9.85143	6.59802	20.9288	65
cluster_7.pdb ( medoid)	5.97963	6.68938	13.0918	40
cluster_8.pdb ( medoid)	5.72373	16.2482	52.2148	93
cluster_9.pdb ( medoid)	5.29505	9.06507	22.2479	48
cluster_10.pdb ( medoid)	4.05791	18.4824	40.1791	75