CABS-dock: 1e75c34623d9fbb

Project name: 1e75c34623d9fbb

Status: done

submitted: 2026-01-22 13:23:13, status changed: 2026-01-22 20:24:37

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	NGSGKPIDGGPRILP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.8568	5.81545	34.6071	162
cluster_2.pdb ( medoid)	26.8137	5.9671	22.0052	160
cluster_3.pdb ( medoid)	18.6958	10.1627	48.5534	190
cluster_4.pdb ( medoid)	13.9157	6.97053	26.7468	97
cluster_5.pdb ( medoid)	9.07468	7.38318	37.0125	67
cluster_6.pdb ( medoid)	8.03332	7.34441	21.2037	59
cluster_7.pdb ( medoid)	6.29193	16.5291	45.0249	104
cluster_8.pdb ( medoid)	5.71508	11.0235	25.8299	63
cluster_9.pdb ( medoid)	2.77813	15.478	34.9401	43
cluster_10.pdb ( medoid)	2.22494	24.7197	49.6413	55