Project name: 1ffec4c0ae5cd15

Status: done

submitted: 2026-01-22 13:08:55, status changed: 2026-01-22 20:06:05

Project settings
Protein sequence(s) VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence EVNGDFIQKEEDTEQE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 16.3062 10.7935 31.6867 176
cluster_2.pdb ( medoid) 15.9025 8.42634 28.9127 134
cluster_3.pdb ( medoid) 15.0496 6.04668 18.0459 91
cluster_4.pdb ( medoid) 13.8604 16.089 37.3164 223
cluster_5.pdb ( medoid) 11.0996 5.85606 12.0348 65
cluster_6.pdb ( medoid) 10.9639 6.29336 11.8991 69
cluster_7.pdb ( medoid) 8.48236 10.7281 35.4067 91
cluster_8.pdb ( medoid) 7.51194 6.52294 26.9374 49
cluster_9.pdb ( medoid) 5.94631 7.56772 15.2144 45
cluster_10.pdb ( medoid) 3.9749 14.34 34.8168 57