CABS-dock: 202ffa1c840253a

Project name: 202ffa1c840253a

Status: done

submitted: 2026-04-09 13:44:39, status changed: 2026-04-10 01:18:44

Project settings

Protein sequence(s)	PYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL input pdb
Peptide sequence	TSYWRRVSL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.8882	5.96749	26.6176	244
cluster_2.pdb ( medoid)	40.7761	5.0765	36.4365	207
cluster_3.pdb ( medoid)	30.7508	3.6747	29.1923	113
cluster_4.pdb ( medoid)	30.493	3.47621	27.2711	106
cluster_5.pdb ( medoid)	18.7689	5.11484	25.7798	96
cluster_6.pdb ( medoid)	13.0579	6.2797	16.5129	82
cluster_7.pdb ( medoid)	10.3758	5.78267	20.112	60
cluster_8.pdb ( medoid)	3.67481	11.4292	31.4748	42
cluster_9.pdb ( medoid)	2.65074	9.05408	17.1734	24
cluster_10.pdb ( medoid)	1.79758	14.4639	32.4399	26