CABS-dock: 20b45fb80030f65

Project name: 20b45fb80030f65

Status: done

submitted: 2026-01-19 14:08:37, status changed: 2026-01-19 23:35:10

Project settings

Protein sequence(s)	QPRKECQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQEKLFFGNMPVINMSLSGQLRVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSELNRFTVVGCNSYAFLRTSGVEKYSTGCISICDSATTKNGSCSGEGCCQIPVPRGYSFVRVKPHSFHNHPTVHLFNPCTYAFLVEDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCTRKVRPEYFRWT input pdb
Peptide sequence	GENQKPMFELAEGATLKNVNLGENE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.4315	2.72498	23.5089	102
cluster_2.pdb ( medoid)	23.5529	4.79772	23.7921	113
cluster_3.pdb ( medoid)	20.6108	6.3559	19.6314	131
cluster_4.pdb ( medoid)	10.0748	7.74207	14.2169	78
cluster_5.pdb ( medoid)	9.36311	11.5346	26.3338	108
cluster_6.pdb ( medoid)	8.08028	9.52938	23.6491	77
cluster_7.pdb ( medoid)	7.29566	10.143	22.8955	74
cluster_8.pdb ( medoid)	5.73805	13.4192	35.3889	77
cluster_9.pdb ( medoid)	1.71151	12.2699	24.9793	21
cluster_10.pdb ( medoid)	1.34835	14.0913	20.7492	19