Project name: 20bf4785a3fa7d9

Status: done

submitted: 2026-02-27 07:41:33, status changed: 2026-02-27 10:04:27

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence VQVFGDNNW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 41.4224 2.2693 10.6411 94
cluster_2.pdb ( medoid) 34.0725 3.72734 15.1444 127
cluster_3.pdb ( medoid) 22.5964 3.80591 13.2378 86
cluster_4.pdb ( medoid) 21.4813 4.65521 11.0365 100
cluster_5.pdb ( medoid) 18.7005 6.84473 18.768 128
cluster_6.pdb ( medoid) 18.4084 7.9855 19.8976 147
cluster_7.pdb ( medoid) 8.08031 12.4995 31.8778 101
cluster_8.pdb ( medoid) 7.46491 13.1281 33.0081 98
cluster_9.pdb ( medoid) 5.96677 7.54177 17.5565 45
cluster_10.pdb ( medoid) 5.43566 13.6138 37.7898 74