CABS-dock: 20bf4785a3fa7d9

Project name: 20bf4785a3fa7d9

Status: done

submitted: 2026-02-27 07:41:33, status changed: 2026-02-27 10:04:27

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	VQVFGDNNW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.4224	2.2693	10.6411	94
cluster_2.pdb ( medoid)	34.0725	3.72734	15.1444	127
cluster_3.pdb ( medoid)	22.5964	3.80591	13.2378	86
cluster_4.pdb ( medoid)	21.4813	4.65521	11.0365	100
cluster_5.pdb ( medoid)	18.7005	6.84473	18.768	128
cluster_6.pdb ( medoid)	18.4084	7.9855	19.8976	147
cluster_7.pdb ( medoid)	8.08031	12.4995	31.8778	101
cluster_8.pdb ( medoid)	7.46491	13.1281	33.0081	98
cluster_9.pdb ( medoid)	5.96677	7.54177	17.5565	45
cluster_10.pdb ( medoid)	5.43566	13.6138	37.7898	74