Project name: 20ef8cfda2ccd80

Status: done

submitted: 2026-05-01 02:44:26, status changed: 2026-05-01 07:51:20

Project settings
Protein sequence(s) PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT input pdb
Peptide sequence VGAVAALR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.0613 3.22293 23.9382 113
cluster_2.pdb ( medoid) 26.1562 9.44327 41.0358 247
cluster_3.pdb ( medoid) 17.6885 6.78406 27.292 120
cluster_4.pdb ( medoid) 12.9676 10.9503 30.5491 142
cluster_5.pdb ( medoid) 12.3268 8.84251 23.0851 109
cluster_6.pdb ( medoid) 8.81123 8.62536 28.9954 76
cluster_7.pdb ( medoid) 5.08024 9.64522 30.4007 49
cluster_8.pdb ( medoid) 3.55449 15.7547 37.252 56
cluster_9.pdb ( medoid) 3.04451 20.0361 42.6404 61
cluster_10.pdb ( medoid) 2.87253 9.39938 25.6899 27