CABS-dock: 20ef8cfda2ccd80

Project name: 20ef8cfda2ccd80

Status: done

submitted: 2026-05-01 02:44:26, status changed: 2026-05-01 07:51:20

Project settings

Protein sequence(s)	PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT input pdb
Peptide sequence	VGAVAALR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.0613	3.22293	23.9382	113
cluster_2.pdb ( medoid)	26.1562	9.44327	41.0358	247
cluster_3.pdb ( medoid)	17.6885	6.78406	27.292	120
cluster_4.pdb ( medoid)	12.9676	10.9503	30.5491	142
cluster_5.pdb ( medoid)	12.3268	8.84251	23.0851	109
cluster_6.pdb ( medoid)	8.81123	8.62536	28.9954	76
cluster_7.pdb ( medoid)	5.08024	9.64522	30.4007	49
cluster_8.pdb ( medoid)	3.55449	15.7547	37.252	56
cluster_9.pdb ( medoid)	3.04451	20.0361	42.6404	61
cluster_10.pdb ( medoid)	2.87253	9.39938	25.6899	27