Project name: 20f67191aeb936

Status: done

submitted: 2026-03-16 09:25:39, status changed: 2026-03-17 02:38:44

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RRRGGVQLFGSNDAGGRRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEECCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.847 3.71897 29.0888 111
cluster_2.pdb ( medoid) 18.534 6.15085 44.2349 114
cluster_3.pdb ( medoid) 17.4838 4.86164 15.6379 85
cluster_4.pdb ( medoid) 15.4421 16.4486 49.9282 254
cluster_5.pdb ( medoid) 9.74405 4.6182 23.6771 45
cluster_6.pdb ( medoid) 8.45081 13.0165 41.2014 110
cluster_7.pdb ( medoid) 6.87349 7.5653 31.9463 52
cluster_8.pdb ( medoid) 6.70191 14.7719 46.8956 99
cluster_9.pdb ( medoid) 4.89492 21.0422 43.3286 103
cluster_10.pdb ( medoid) 2.65657 10.1635 26.5856 27