CABS-dock: 20f67191aeb936

Project name: 20f67191aeb936

Status: done

submitted: 2026-03-16 09:25:39, status changed: 2026-03-17 02:38:44

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRGGVQLFGSNDAGGRRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEECCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.847	3.71897	29.0888	111
cluster_2.pdb ( medoid)	18.534	6.15085	44.2349	114
cluster_3.pdb ( medoid)	17.4838	4.86164	15.6379	85
cluster_4.pdb ( medoid)	15.4421	16.4486	49.9282	254
cluster_5.pdb ( medoid)	9.74405	4.6182	23.6771	45
cluster_6.pdb ( medoid)	8.45081	13.0165	41.2014	110
cluster_7.pdb ( medoid)	6.87349	7.5653	31.9463	52
cluster_8.pdb ( medoid)	6.70191	14.7719	46.8956	99
cluster_9.pdb ( medoid)	4.89492	21.0422	43.3286	103
cluster_10.pdb ( medoid)	2.65657	10.1635	26.5856	27