Project name: 214c36f5951389f

Status: done

submitted: 2026-01-14 13:53:49, status changed: 2026-01-15 02:01:26

Project settings
Protein sequence(s) QIIPSNTTSPPTNSTSPPTNATAPAPSPTNTITKAANITKPGCPKQCGNVTVPYPFGIGSGCALDPMFEIDCNVTTPFIGNIQIYDISDAEMRISNFINTKCYSQTGVLIQDIPSWITLGTKSPYTFSTLNRFIVVGCDDGAIVSGNNFANGCPSLCTSTNDIVKGKCMGFGCCQITIPKGLKFFNTTMVTTRNHSLIWSFNPCGHSFLGEASRFEFQGIEDLSDVNFANKIRNNVPIVLDWAIGNLSCVEARKSNDYACLNNSQCVDSDTSLGGYRCSCNSGYIGNPYIGSGCQDIDECADPNTNSCEKICTNIPGSYNCSCPEGYTGDGRKNGRGCIAPNSNSEFPWIK input pdb
Peptide sequence NTHLKIDNFKADDFGTMVRTNGGKQFDDMS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCEEECCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.199 5.66065 34.8755 120
cluster_2.pdb ( medoid) 16.3412 6.36428 23.7683 104
cluster_3.pdb ( medoid) 15.3066 8.16639 19.5311 125
cluster_4.pdb ( medoid) 11.7253 6.4817 19.32 76
cluster_5.pdb ( medoid) 11.5942 8.62499 17.8293 100
cluster_6.pdb ( medoid) 10.1401 7.49497 21.9994 76
cluster_7.pdb ( medoid) 8.45774 12.06 33.0931 102
cluster_8.pdb ( medoid) 6.90024 4.34768 15.4344 30
cluster_9.pdb ( medoid) 4.38719 11.6248 24.1905 51
cluster_10.pdb ( medoid) 1.58332 10.1053 15.2856 16