Project name: 21aa6ce331606df

Status: done

submitted: 2026-02-26 08:46:11, status changed: 2026-02-26 15:34:58

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQVFGSNCY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.8931 7.56232 24.4243 158
cluster_2.pdb ( medoid) 17.2324 7.42789 47.5178 128
cluster_3.pdb ( medoid) 16.7597 6.62304 33.2878 111
cluster_4.pdb ( medoid) 8.59781 15.469 47.2717 133
cluster_5.pdb ( medoid) 6.49563 11.5462 21.3051 75
cluster_6.pdb ( medoid) 6.29515 15.2498 35.8717 96
cluster_7.pdb ( medoid) 5.70861 14.0139 34.5941 80
cluster_8.pdb ( medoid) 4.95217 17.9719 48.5081 89
cluster_9.pdb ( medoid) 4.50736 19.0799 53.3296 86
cluster_10.pdb ( medoid) 3.10395 14.1755 35.0296 44