Project name: LVFLGGEQRAYPDHSLSTLPEIMKRLQHGL_FAPdock

Status: done

submitted: 2025-10-07 22:05:01, status changed: 2025-10-08 03:20:07

Project settings
Protein sequence(s) IQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFS input pdb
Peptide sequence LVFLGGEQRAYPDHSLSTLPEIMKRLQHGL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCHHHHHHHHHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.9549 3.49022 15.1091 122
cluster_2.pdb ( medoid) 32.2785 2.01372 13.9059 65
cluster_3.pdb ( medoid) 22.4482 4.81109 38.3495 108
cluster_4.pdb ( medoid) 15.0909 7.62047 26.9808 115
cluster_5.pdb ( medoid) 11.2396 6.49488 21.416 73
cluster_6.pdb ( medoid) 10.9024 8.98881 40.2585 98
cluster_7.pdb ( medoid) 9.69388 12.8947 40.8919 125
cluster_8.pdb ( medoid) 8.09431 17.7903 45.0754 144
cluster_9.pdb ( medoid) 6.75423 6.51444 24.7688 44
cluster_10.pdb ( medoid) 6.08262 17.4267 47.3093 106