CABS-dock: 23514fb6f089ee9

Project name: 23514fb6f089ee9

Status: done

submitted: 2026-06-03 22:03:49, status changed: 2026-06-03 23:20:01

Project settings

Protein sequence(s)	PEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEF input pdb
Peptide sequence	DKIDDTAG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	43.996	5.95508	15.4063	262
cluster_2.pdb ( medoid)	31.5105	2.72925	8.18217	86
cluster_3.pdb ( medoid)	23.3263	7.37366	21.1731	172
cluster_4.pdb ( medoid)	22.0448	5.26201	35.1635	116
cluster_5.pdb ( medoid)	13.4471	5.27993	23.2197	71
cluster_6.pdb ( medoid)	12.1184	7.50926	23.6708	91
cluster_7.pdb ( medoid)	9.49759	4.52747	10.1209	43
cluster_8.pdb ( medoid)	9.10947	7.57454	27.3175	69
cluster_9.pdb ( medoid)	5.20702	6.91375	13.7382	36
cluster_10.pdb ( medoid)	5.00695	10.785	35.5494	54