CABS-dock: SVHRSP28

Project name: SVHRSP28_OLR1

Status: done

submitted: 2026-04-19 06:50:30, status changed: 2026-04-19 12:10:36

Project settings

Protein sequence(s)	SHMMPPCPQDWIWHGENCYLFSSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISSYSSSFPFWMMGLSRRNPSYPWLWEDGSPLMMPHLFRRVRRGAVSQTYPSGTCAYIQRRGAVYAENCILAAFSICQQKKANNLLRAQSHMPCPQDWIWHGEENCYLLFSSSGSFNWEKSQEKKCLSSLDAKLLKINNSTADLDFIQQAISYSSFPFWMMGLSRRRNPSYPWLWEDGSPLMMPHLFRVRGAVVSSQQTYPSGTCAYIQRGAVYAENCILAAFSICQQKKKANLRAQ input pdb
Peptide sequence	KVLNGPEEE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.1404	4.30309	28.0015	134
cluster_2.pdb ( medoid)	27.9234	5.33603	14.0391	149
cluster_3.pdb ( medoid)	25.4321	5.19029	28.6432	132
cluster_4.pdb ( medoid)	22.2212	4.99523	44.7431	111
cluster_5.pdb ( medoid)	17.1878	7.79623	24.3579	134
cluster_6.pdb ( medoid)	15.7481	8.38197	40.7272	132
cluster_7.pdb ( medoid)	8.1916	7.56873	36.2826	62
cluster_8.pdb ( medoid)	7.77568	6.4303	23.4093	50
cluster_9.pdb ( medoid)	7.44087	10.2139	34.8655	76
cluster_10.pdb ( medoid)	1.42323	14.0525	26.1132	20