Project name: 6I2G_ALFA_blind_run1

Status: done

submitted: 2026-07-24 03:38:56, status changed: 2026-07-24 05:22:19

Project settings
Protein sequence(s) VQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSS input pdb
Peptide sequence SRLEEELRRRLTE
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHC
Contact information
105:A 2:PEP 5.0 1.0
112:A 10:PEP 5.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 74.7844 2.09937 9.58633 157
cluster_2.pdb ( medoid) 44.0298 2.27119 9.55356 100
cluster_3.pdb ( medoid) 25.7801 5.66329 11.4522 146
cluster_4.pdb ( medoid) 21.6815 5.62691 10.1769 122
cluster_5.pdb ( medoid) 19.6614 5.64558 15.1396 111
cluster_6.pdb ( medoid) 18.7715 5.11414 10.8209 96
cluster_7.pdb ( medoid) 17.5003 3.65707 9.32146 64
cluster_8.pdb ( medoid) 14.7025 7.48173 18.7714 110
cluster_9.pdb ( medoid) 12.4585 3.37118 6.69623 42
cluster_10.pdb ( medoid) 9.37387 5.54734 12.3283 52