Project name: 248a390220260d0

Status: done

submitted: 2026-03-18 09:17:44, status changed: 2026-03-18 22:47:23

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RRRRVQLFGDNAYRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.3882 4.23539 32.1367 116
cluster_2.pdb ( medoid) 17.5158 8.56368 23.2647 150
cluster_3.pdb ( medoid) 12.3463 8.0996 24.1253 100
cluster_4.pdb ( medoid) 10.8927 12.0263 44.1847 131
cluster_5.pdb ( medoid) 7.29895 9.1794 24.3703 67
cluster_6.pdb ( medoid) 5.50377 12.9002 28.5562 71
cluster_7.pdb ( medoid) 5.44605 10.4663 39.9096 57
cluster_8.pdb ( medoid) 4.99907 11.6022 29.4205 58
cluster_9.pdb ( medoid) 4.93778 15.7966 33.6928 78
cluster_10.pdb ( medoid) 3.29697 21.8382 42.2561 72