CABS-dock: 24c53675bbd1769

Project name: 24c53675bbd1769

Status: done

submitted: 2025-05-29 17:04:16, status changed: 2025-05-29 18:20:52

Project settings

Protein sequence(s)	MICYNQQSSQPPTTKTCSETSCYKKTWRDHRGTIIERGCGCPKVKPGIKLHCCRTDKCNN input pdb
Peptide sequence	SCYKKTWRD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.0922	3.58566	13.7954	133
cluster_2.pdb ( medoid)	36.4664	3.34554	8.86737	122
cluster_3.pdb ( medoid)	28.9199	5.01386	25.5116	145
cluster_4.pdb ( medoid)	27.1312	4.01751	12.9747	109
cluster_5.pdb ( medoid)	20.6537	4.06708	11.411	84
cluster_6.pdb ( medoid)	16.507	5.93686	18.3339	98
cluster_7.pdb ( medoid)	15.8253	7.51961	18.1526	119
cluster_8.pdb ( medoid)	15.6539	5.49385	11.1593	86
cluster_9.pdb ( medoid)	6.34077	8.98944	21.0426	57
cluster_10.pdb ( medoid)	4.56769	10.2897	20.6527	47