Project name: 25d41e89bda3353

Status: done

submitted: 2026-04-03 03:01:33, status changed: 2026-04-03 07:55:41

Project settings
Protein sequence(s) ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY input pdb
Peptide sequence MQQNGYENPTYK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.4361 5.39435 20.117 148
cluster_2.pdb ( medoid) 22.3299 5.64267 28.5573 126
cluster_3.pdb ( medoid) 14.4895 12.0777 35.4301 175
cluster_4.pdb ( medoid) 14.0726 5.89799 13.2359 83
cluster_5.pdb ( medoid) 14.0066 9.35275 23.065 131
cluster_6.pdb ( medoid) 8.99956 8.66709 20.4071 78
cluster_7.pdb ( medoid) 8.07719 8.17116 19.4981 66
cluster_8.pdb ( medoid) 7.92044 6.18653 13.8333 49
cluster_9.pdb ( medoid) 7.86515 16.02 29.0694 126
cluster_10.pdb ( medoid) 1.68308 10.6947 19.311 18