Project name: 263de0f4ce8b9e5

Status: done

submitted: 2026-07-08 09:34:33, status changed: 2026-07-08 13:44:56

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence ADTHERGWGYGNLRK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 44.2476 2.30521 23.4546 102
cluster_2.pdb ( medoid) 17.4419 8.82931 35.1253 154
cluster_3.pdb ( medoid) 12.2419 14.7036 28.9908 180
cluster_4.pdb ( medoid) 12.0949 5.78759 18.0692 70
cluster_5.pdb ( medoid) 9.86482 11.6576 34.4784 115
cluster_6.pdb ( medoid) 9.70213 9.79166 29.2553 95
cluster_7.pdb ( medoid) 8.59029 16.9959 37.8303 146
cluster_8.pdb ( medoid) 7.40501 9.45306 31.0186 70
cluster_9.pdb ( medoid) 7.10166 5.06924 12.205 36
cluster_10.pdb ( medoid) 6.77649 4.72221 8.24364 32