Project name: 26e1f9db1ae8293

Status: done

submitted: 2026-07-23 10:36:47, status changed: 2026-07-23 12:30:12

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIFVQCGFSNCFR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.9893 4.50173 23.3011 126
cluster_2.pdb ( medoid) 23.7199 5.94439 21.9722 141
cluster_3.pdb ( medoid) 21.1784 6.65772 22.4181 141
cluster_4.pdb ( medoid) 19.313 6.0063 24.3021 116
cluster_5.pdb ( medoid) 8.21731 16.0637 33.9963 132
cluster_6.pdb ( medoid) 7.76391 8.75847 24.0794 68
cluster_7.pdb ( medoid) 7.63953 7.59209 28.3484 58
cluster_8.pdb ( medoid) 6.51104 13.0548 24.5277 85
cluster_9.pdb ( medoid) 5.38917 13.5457 34.8475 73
cluster_10.pdb ( medoid) 4.59901 13.0463 29.4684 60