Project name: 27924e124579a1c

Status: done

submitted: 2025-08-01 13:18:42, status changed: 2025-08-01 19:46:06

Project settings
Protein sequence(s) MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYKGDYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV input pdb
Peptide sequence KSPLY
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.6972 3.58571 25.4811 128
cluster_2.pdb ( medoid) 19.5416 6.34543 35.9571 124
cluster_3.pdb ( medoid) 19.1067 6.64687 26.0044 127
cluster_4.pdb ( medoid) 17.4891 7.83344 33.7027 137
cluster_5.pdb ( medoid) 14.0307 6.62831 30.0054 93
cluster_6.pdb ( medoid) 13.1679 9.72064 47.6538 128
cluster_7.pdb ( medoid) 11.6814 5.82124 21.1865 68
cluster_8.pdb ( medoid) 10.0154 6.29031 31.5723 63
cluster_9.pdb ( medoid) 8.2366 9.34851 28.5604 77
cluster_10.pdb ( medoid) 3.72305 14.7728 45.4452 55