CABS-dock: 27c04b0c33b4055

Project name: 27c04b0c33b4055

Status: done

submitted: 2025-12-30 15:29:15, status changed: 2025-12-31 03:19:15

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RVIVQCGSNSFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.9893	5.24077	36.4039	110
cluster_2.pdb ( medoid)	18.4786	6.5481	23.0034	121
cluster_3.pdb ( medoid)	14.2879	7.20892	38.7988	103
cluster_4.pdb ( medoid)	13.729	12.2368	47.1109	168
cluster_5.pdb ( medoid)	10.103	9.40315	25.7623	95
cluster_6.pdb ( medoid)	7.87855	13.4543	38.4561	106
cluster_7.pdb ( medoid)	7.38369	12.4599	27.0273	92
cluster_8.pdb ( medoid)	6.20318	15.7983	36.7733	98
cluster_9.pdb ( medoid)	3.57121	21.2813	48.8213	76
cluster_10.pdb ( medoid)	1.40186	22.1135	49.4811	31