Project name: DRAMP00802M

Status: done

submitted: 2024-07-25 15:33:10, status changed: 2024-07-25 23:13:36

Project settings
Protein sequence(s) SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ input pdb
Peptide sequence GFPCGESCVFIPCISAAIGCSCKNKVCYRN
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEECCCHHHHCCCCCCCEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.0557 3.22002 5.69775 100
cluster_2.pdb ( medoid) 27.0749 2.8809 6.34065 78
cluster_3.pdb ( medoid) 25.7902 5.3121 14.8121 137
cluster_4.pdb ( medoid) 25.0981 5.0203 18.9763 126
cluster_5.pdb ( medoid) 20.137 8.93879 28.0863 180
cluster_6.pdb ( medoid) 9.66404 14.0728 30.3981 136
cluster_7.pdb ( medoid) 8.7665 6.6161 14.6572 58
cluster_8.pdb ( medoid) 7.15966 11.8721 26.9802 85
cluster_9.pdb ( medoid) 3.78386 9.24981 16.8428 35
cluster_10.pdb ( medoid) 3.70462 17.5457 33.8412 65