Project name: 284f67d6a03b254

Status: done

submitted: 2025-08-24 04:53:32, status changed: 2025-08-24 07:57:36

Project settings
Protein sequence(s) SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence NDIEYNAPSEIKNHGARQLY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCHHHHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 59.3491 1.75234 18.6203 104
cluster_2.pdb ( medoid) 20.4831 5.22381 24.8345 107
cluster_3.pdb ( medoid) 15.0844 8.94965 32.0934 135
cluster_4.pdb ( medoid) 14.5547 8.03864 27.9555 117
cluster_5.pdb ( medoid) 14.4161 10.96 29.8515 158
cluster_6.pdb ( medoid) 8.3252 10.0898 28.1868 84
cluster_7.pdb ( medoid) 6.26382 12.9314 24.3678 81
cluster_8.pdb ( medoid) 5.94103 15.1489 34.5315 90
cluster_9.pdb ( medoid) 5.09258 16.2982 31.4161 83
cluster_10.pdb ( medoid) 4.51659 9.07765 26.065 41