CABS-dock: 284f67d6a03b254

Project name: 284f67d6a03b254

Status: done

submitted: 2025-08-24 04:53:32, status changed: 2025-08-24 07:57:36

Project settings

Protein sequence(s)	SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence	NDIEYNAPSEIKNHGARQLY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCHHHHHCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	59.3491	1.75234	18.6203	104
cluster_2.pdb ( medoid)	20.4831	5.22381	24.8345	107
cluster_3.pdb ( medoid)	15.0844	8.94965	32.0934	135
cluster_4.pdb ( medoid)	14.5547	8.03864	27.9555	117
cluster_5.pdb ( medoid)	14.4161	10.96	29.8515	158
cluster_6.pdb ( medoid)	8.3252	10.0898	28.1868	84
cluster_7.pdb ( medoid)	6.26382	12.9314	24.3678	81
cluster_8.pdb ( medoid)	5.94103	15.1489	34.5315	90
cluster_9.pdb ( medoid)	5.09258	16.2982	31.4161	83
cluster_10.pdb ( medoid)	4.51659	9.07765	26.065	41