CABS-dock: primed p28

Project name: primed p28

Status: done

submitted: 2025-05-09 14:50:04, status changed: 2025-05-09 17:59:01

Project settings

Protein sequence(s)	TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence	MQKLWW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.2665	6.15038	27.9363	180
cluster_2.pdb ( medoid)	28.6332	3.49245	10.2707	100
cluster_3.pdb ( medoid)	22.988	4.39359	19.5319	101
cluster_4.pdb ( medoid)	21.0911	5.73701	15.3292	121
cluster_5.pdb ( medoid)	16.5034	10.6644	36.0285	176
cluster_6.pdb ( medoid)	15.569	7.25802	33.1782	113
cluster_7.pdb ( medoid)	12.4393	7.39591	29.9715	92
cluster_8.pdb ( medoid)	5.91956	9.29123	30.4656	55
cluster_9.pdb ( medoid)	4.29646	10.241	29.1301	44
cluster_10.pdb ( medoid)	1.61056	11.1762	27.6004	18