CABS-dock: 295cc50837d528a

Project name: 295cc50837d528a

Status: done

submitted: 2026-07-27 12:07:07, status changed: 2026-07-27 13:07:41

Project settings

Protein sequence(s)	MKCTSMFLVLAMVVLMAQPGEGIIGLLIHGIVQAVHGIKKLVNGKENLAEEQADQQQLDKHLFQFRHQQKHFD input pdb
Peptide sequence	FIHHIFRGIVHAGRSIGRFLTG
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.9631	7.53111	39.4996	188
cluster_2.pdb ( medoid)	24.3972	6.35319	30.6348	155
cluster_3.pdb ( medoid)	20.0643	5.88108	24.4542	118
cluster_4.pdb ( medoid)	17.3209	8.08274	27.6264	140
cluster_5.pdb ( medoid)	13.9936	11.5767	40.7963	162
cluster_6.pdb ( medoid)	10.9823	8.01288	44.6089	88
cluster_7.pdb ( medoid)	7.64145	7.45932	25.0665	57
cluster_8.pdb ( medoid)	7.2211	6.37022	34.2697	46
cluster_9.pdb ( medoid)	2.19882	14.5532	28.8451	32
cluster_10.pdb ( medoid)	0.710257	19.7112	33.015	14