CABS-dock: 29b677d0fbb44c9

Project name: 29b677d0fbb44c9

Status: done

submitted: 2026-03-16 10:24:43, status changed: 2026-03-16 14:35:10

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQLFGSNDARRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.0304	5.38418	28.8238	124
cluster_2.pdb ( medoid)	21.1632	6.04824	35.2235	128
cluster_3.pdb ( medoid)	13.1256	10.209	46.5663	134
cluster_4.pdb ( medoid)	6.39627	15.4778	37.0399	99
cluster_5.pdb ( medoid)	6.26464	14.2067	27.7356	89
cluster_6.pdb ( medoid)	6.24919	11.6815	41.5695	73
cluster_7.pdb ( medoid)	5.92976	15.1777	37.3009	90
cluster_8.pdb ( medoid)	5.52415	15.749	43.9835	87
cluster_9.pdb ( medoid)	5.35403	18.1172	54.9852	97
cluster_10.pdb ( medoid)	4.33333	18.2308	40.386	79