CABS-dock: 8TBP_ANHPAA

Project name: 8TBP_ANHPAA_E2

Status: done

submitted: 2026-05-30 16:18:18, status changed: 2026-05-31 07:14:17

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	ANHPAATHTKAVALGTEE
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCCHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.4239	4.44867	27.4829	122
cluster_2.pdb ( medoid)	19.5726	6.18212	39.5026	121
cluster_3.pdb ( medoid)	17.5315	8.44197	24.7839	148
cluster_4.pdb ( medoid)	10.3585	9.94348	34.4113	103
cluster_5.pdb ( medoid)	9.10597	9.88363	44.3262	90
cluster_6.pdb ( medoid)	9.06318	8.38558	32.9165	76
cluster_7.pdb ( medoid)	8.98628	8.56862	28.5891	77
cluster_8.pdb ( medoid)	8.12323	10.3407	26.5037	84
cluster_9.pdb ( medoid)	8.02309	13.8351	29.8751	111
cluster_10.pdb ( medoid)	5.31378	11.4796	49.3112	61