CABS-dock: 5hto&Pep3

Project name: 5hto&Pep3

Status: done

submitted: 2025-02-04 08:28:28, status changed: 2025-02-04 17:22:22

Project settings

Protein sequence(s)	KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI input pdb
Peptide sequence	LFKRTFEFVWGMWQ
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.0451	3.99513	13.2596	148
cluster_2.pdb ( medoid)	35.1267	4.35566	14.7565	153
cluster_3.pdb ( medoid)	27.4716	4.36814	29.2893	120
cluster_4.pdb ( medoid)	26.0167	5.49648	37.5849	143
cluster_5.pdb ( medoid)	21.495	3.39614	9.58089	73
cluster_6.pdb ( medoid)	16.9044	7.69029	19.9665	130
cluster_7.pdb ( medoid)	12.3574	9.79167	50.6536	121
cluster_8.pdb ( medoid)	4.97907	9.23867	21.1741	46
cluster_9.pdb ( medoid)	4.35893	9.17656	17.4186	40
cluster_10.pdb ( medoid)	3.9977	6.50374	13.1932	26