Project name: 2bd66368d22ee44

Status: done

submitted: 2026-03-13 06:05:39, status changed: 2026-03-13 18:50:01

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RRMKWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.2906 10.0598 40.4472 184
cluster_2.pdb ( medoid) 16.4518 4.61957 23.7767 76
cluster_3.pdb ( medoid) 15.6087 9.41783 28.6766 147
cluster_4.pdb ( medoid) 15.5439 8.87806 38.9648 138
cluster_5.pdb ( medoid) 6.22491 9.47806 33.4606 59
cluster_6.pdb ( medoid) 6.02772 13.272 49.5322 80
cluster_7.pdb ( medoid) 5.72858 19.7257 48.432 113
cluster_8.pdb ( medoid) 4.89932 15.3082 34.2012 75
cluster_9.pdb ( medoid) 4.56866 17.0729 36.7321 78
cluster_10.pdb ( medoid) 1.92277 26.0041 51.3459 50