CABS-dock: 2bd66368d22ee44

Project name: 2bd66368d22ee44

Status: done

submitted: 2026-03-13 06:05:39, status changed: 2026-03-13 18:50:01

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRMKWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.2906	10.0598	40.4472	184
cluster_2.pdb ( medoid)	16.4518	4.61957	23.7767	76
cluster_3.pdb ( medoid)	15.6087	9.41783	28.6766	147
cluster_4.pdb ( medoid)	15.5439	8.87806	38.9648	138
cluster_5.pdb ( medoid)	6.22491	9.47806	33.4606	59
cluster_6.pdb ( medoid)	6.02772	13.272	49.5322	80
cluster_7.pdb ( medoid)	5.72858	19.7257	48.432	113
cluster_8.pdb ( medoid)	4.89932	15.3082	34.2012	75
cluster_9.pdb ( medoid)	4.56866	17.0729	36.7321	78
cluster_10.pdb ( medoid)	1.92277	26.0041	51.3459	50