CABS-dock: 2V8C

Project name: 2V8C

Status: done

submitted: 2026-03-19 19:50:24, status changed: 2026-03-19 23:09:51

Project settings

Protein sequence(s)	AGWQSYVDNLMCCDGCCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF input pdb
Peptide sequence	GPPPPPGPPPPPGPPPPPGL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.2279	12.3412	37.126	299
cluster_2.pdb ( medoid)	13.4006	6.26838	24.41	84
cluster_3.pdb ( medoid)	12.2218	8.67305	31.5201	106
cluster_4.pdb ( medoid)	11.8256	6.17303	20.5079	73
cluster_5.pdb ( medoid)	11.307	6.63305	21.2388	75
cluster_6.pdb ( medoid)	11.2713	8.42848	19.8903	95
cluster_7.pdb ( medoid)	10.1524	13.9868	27.5344	142
cluster_8.pdb ( medoid)	5.89331	11.7082	33.0355	69
cluster_9.pdb ( medoid)	2.87035	11.8452	29.2742	34
cluster_10.pdb ( medoid)	2.21334	10.3915	30.2028	23