Project name: 2dx4

Status: done

submitted: 2025-12-12 14:28:44, status changed: 2025-12-12 16:02:23

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence INYWLAHAKAGYIVHWTA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.5807 2.92504 19.172 107
cluster_2.pdb ( medoid) 23.2214 5.89973 26.1825 137
cluster_3.pdb ( medoid) 20.9455 4.96527 32.3561 104
cluster_4.pdb ( medoid) 16.4373 8.88226 25.5454 146
cluster_5.pdb ( medoid) 13.4057 10.145 23.0294 136
cluster_6.pdb ( medoid) 8.66944 10.3813 24.2759 90
cluster_7.pdb ( medoid) 7.55395 10.8553 24.9879 82
cluster_8.pdb ( medoid) 7.0341 7.39256 15.8918 52
cluster_9.pdb ( medoid) 6.4948 12.0096 22.6591 78
cluster_10.pdb ( medoid) 4.81694 14.1169 30.8213 68