Project name: 2c58e0fd829f6fd

Status: done

submitted: 2026-03-12 15:56:25, status changed: 2026-03-12 22:30:20

Project settings
Protein sequence(s) MEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDAGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN input pdb
Peptide sequence GGWFRSLV
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.4329 5.58333 29.5686 142
cluster_2.pdb ( medoid) 19.0585 6.13898 24.1729 117
cluster_3.pdb ( medoid) 15.0355 8.11413 21.2757 122
cluster_4.pdb ( medoid) 14.2185 9.56501 36.0799 136
cluster_5.pdb ( medoid) 13.5803 9.86723 21.4766 134
cluster_6.pdb ( medoid) 12.2326 7.27567 25.3676 89
cluster_7.pdb ( medoid) 11.5526 11.7722 28.0175 136
cluster_8.pdb ( medoid) 6.8987 6.66792 29.0597 46
cluster_9.pdb ( medoid) 3.54691 14.3787 30.5277 51
cluster_10.pdb ( medoid) 2.98826 9.03537 16.6234 27