CABS-dock: 2c98f54d416883

Project name: 2c98f54d416883

Status: done

submitted: 2026-03-12 14:56:26, status changed: 2026-03-12 18:50:51

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVQLFGSNDAR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.7317	8.30756	21.544	139
cluster_2.pdb ( medoid)	15.4542	7.76488	28.558	120
cluster_3.pdb ( medoid)	14.7521	8.60896	27.7244	127
cluster_4.pdb ( medoid)	9.1384	14.0068	31.2999	128
cluster_5.pdb ( medoid)	8.56028	14.836	31.2145	127
cluster_6.pdb ( medoid)	6.59763	11.2161	35.033	74
cluster_7.pdb ( medoid)	6.51299	11.0548	37.1755	72
cluster_8.pdb ( medoid)	4.93723	16.0009	48.5903	79
cluster_9.pdb ( medoid)	4.65419	15.6848	39.5985	73
cluster_10.pdb ( medoid)	4.52319	13.4861	29.7246	61