CABS-dock: 2ce499cd383aa32

Project name: 2ce499cd383aa32

Status: done

submitted: 2026-03-18 07:40:50, status changed: 2026-03-18 09:13:00

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RRRRVQVFGSNTYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.4627	2.5999	24.2549	74
cluster_2.pdb ( medoid)	27.7844	3.63514	22.8344	101
cluster_3.pdb ( medoid)	27.1873	6.1058	19.3796	166
cluster_4.pdb ( medoid)	22.6454	7.46289	26.3185	169
cluster_5.pdb ( medoid)	18.7854	6.01532	28.1582	113
cluster_6.pdb ( medoid)	13.5251	5.02768	12.0107	68
cluster_7.pdb ( medoid)	13.2019	8.71084	26.148	115
cluster_8.pdb ( medoid)	12.6095	3.64804	10.0411	46
cluster_9.pdb ( medoid)	6.6743	13.6344	31.6828	91
cluster_10.pdb ( medoid)	6.46954	8.81052	25.4071	57