CABS-dock: AR_LBD__FOXO1

Project name: AR_LBD__FOXO1_LXXLL

Status: done

submitted: 2026-06-17 07:39:42, status changed: 2026-06-17 15:10:22

Project settings

Protein sequence(s)	PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIATSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ input pdb
Peptide sequence	NCAPGLLKELLTSDSPPHNDIMTPVDPGVA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHHHCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.3608	4.47946	15.5384	136
cluster_2.pdb ( medoid)	25.9513	4.20018	14.7395	109
cluster_3.pdb ( medoid)	16.8681	5.98765	28.2359	101
cluster_4.pdb ( medoid)	11.6484	9.61509	48.436	112
cluster_5.pdb ( medoid)	7.28691	15.2328	26.4338	111
cluster_6.pdb ( medoid)	7.18708	11.9659	47.078	86
cluster_7.pdb ( medoid)	6.32694	15.0152	52.8403	95
cluster_8.pdb ( medoid)	5.54636	13.883	27.4524	77
cluster_9.pdb ( medoid)	4.68414	13.0227	24.5149	61
cluster_10.pdb ( medoid)	3.50249	11.1349	21.7057	39