CABS-dock: 251229 IgV_Only

Project name: 251229 IgV_Only_8

Status: done

submitted: 2025-12-29 08:40:25, status changed: 2025-12-29 11:48:12

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	WHRSYYTWNLNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.7288	3.01949	10.6819	126
cluster_2.pdb ( medoid)	23.4916	8.8968	24.6061	209
cluster_3.pdb ( medoid)	20.2346	5.48565	24.8438	111
cluster_4.pdb ( medoid)	19.4409	7.04699	20.5802	137
cluster_5.pdb ( medoid)	17.1002	8.42093	34.8608	144
cluster_6.pdb ( medoid)	8.2114	9.01186	18.7709	74
cluster_7.pdb ( medoid)	7.61887	8.6627	31.4828	66
cluster_8.pdb ( medoid)	7.41199	7.4204	17.4714	55
cluster_9.pdb ( medoid)	4.52063	9.95437	22.5416	45
cluster_10.pdb ( medoid)	3.16358	10.4312	24.3098	33