CABS-dock: C-H-134

Project name: C-H-134_4

Status: done

submitted: 2025-02-04 08:25:11, status changed: 2025-02-05 02:01:48

Project settings

Protein sequence(s)

MNMNVLVLCFVLSVSAEGLHVDRQVIGCSDHDGEQAYNLDGEEMWFADFIKREGVEPQPPFIDHITYVDGTYQGAEANQHVCKSNLDVSRTAMKDFKIEDEPPSSPMIYTRDAVELGGENTLICHVTGFYPAPVHVYWTKNGVDVTEGTSLNVPYPNTDGSFRQTARLKFIAQQGDVYSCTVSHLALDQSLTKIWDVDVQQPSVGPAVFCGVGLSVGLLGVAAGTFFLIKGNECSMASFILSFSLFFITVCTANGFRYYVVNSCEFNSSKLNDIEFTESYYYNKLEYIRFSSSVGKFVGYTEHGIKNAERWNNGPEVISSRGEKERYCLNNVGVDVESALTNTQTLRQASLCGAPSWQTCMLVCSVFDFYPKRIKVSWQRDGQEVTSDVTSTDELADGDWYYQIHSHLEYMPKSGEKISCVVEHASLSKPLITDWDPSMPESERNKIAIGTSGLILGLTLSLAGFIYYKRKAQGRILVPTN input pdb

Peptide sequence

SVFDADAGISLNDNF

Simulation mc cycles

Peptide secondary structure psipred

CCCCCCCCCCCCCCC

Flexible regions

108:B - 18:B

100:A - 19:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	81.0709	1.23349	2.58424	100
cluster_2.pdb ( medoid)	53.1093	2.31598	5.58691	123
cluster_3.pdb ( medoid)	35.2603	3.54507	9.738	125
cluster_4.pdb ( medoid)	20.0548	3.78961	24.0696	76
cluster_5.pdb ( medoid)	19.9435	5.01416	12.5454	100
cluster_6.pdb ( medoid)	9.48269	15.3965	45.2561	146
cluster_7.pdb ( medoid)	8.43899	5.0954	14.8724	43
cluster_8.pdb ( medoid)	6.63077	21.4153	56.5653	142
cluster_9.pdb ( medoid)	3.40176	12.6405	39.7733	43
cluster_10.pdb ( medoid)	1.0975	17.3121	38.8076	19