Project name: 2e124c67847f6b8

Status: done

submitted: 2026-03-09 08:47:04, status changed: 2026-03-09 14:34:04

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.7797 7.50813 31.405 141
cluster_2.pdb ( medoid) 14.4432 12.6011 53.3512 182
cluster_3.pdb ( medoid) 9.45493 8.99002 38.317 85
cluster_4.pdb ( medoid) 9.27398 13.6942 52.0354 127
cluster_5.pdb ( medoid) 7.33698 6.6785 33.8934 49
cluster_6.pdb ( medoid) 7.01588 11.5452 41.7317 81
cluster_7.pdb ( medoid) 6.9602 13.7927 41.9288 96
cluster_8.pdb ( medoid) 6.32162 16.2933 42.9295 103
cluster_9.pdb ( medoid) 4.37948 18.267 40.9226 80
cluster_10.pdb ( medoid) 2.59657 21.567 55.5041 56