Project name: 2f79b3e5a5a6abb

Status: done

submitted: 2025-12-27 14:58:28, status changed: 2025-12-27 23:00:33

Project settings
Protein sequence(s) KPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFALCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC input pdb
Peptide sequence LLTHTISRIAVSYQTKVNLL
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECEEEEEEHHCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 90.4834 0.607846 2.58751 55
cluster_2.pdb ( medoid) 35.6274 5.44524 12.6902 194
cluster_3.pdb ( medoid) 33.2744 0.721276 1.82543 24
cluster_4.pdb ( medoid) 19.4256 6.2289 34.6056 121
cluster_5.pdb ( medoid) 14.8339 11.1906 42.1716 166
cluster_6.pdb ( medoid) 8.15784 12.6259 27.5113 103
cluster_7.pdb ( medoid) 5.11701 14.657 33.8428 75
cluster_8.pdb ( medoid) 4.59528 20.2382 49.4532 93
cluster_9.pdb ( medoid) 4.17106 7.91165 21.578 33
cluster_10.pdb ( medoid) 2.28803 15.7341 39.241 36