CABS-dock: 2f79b3e5a5a6abb

Project name: 2f79b3e5a5a6abb

Status: done

submitted: 2025-12-27 14:58:28, status changed: 2025-12-27 23:00:33

Project settings

Protein sequence(s)	KPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFALCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC input pdb
Peptide sequence	LLTHTISRIAVSYQTKVNLL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECEEEEEEHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	90.4834	0.607846	2.58751	55
cluster_2.pdb ( medoid)	35.6274	5.44524	12.6902	194
cluster_3.pdb ( medoid)	33.2744	0.721276	1.82543	24
cluster_4.pdb ( medoid)	19.4256	6.2289	34.6056	121
cluster_5.pdb ( medoid)	14.8339	11.1906	42.1716	166
cluster_6.pdb ( medoid)	8.15784	12.6259	27.5113	103
cluster_7.pdb ( medoid)	5.11701	14.657	33.8428	75
cluster_8.pdb ( medoid)	4.59528	20.2382	49.4532	93
cluster_9.pdb ( medoid)	4.17106	7.91165	21.578	33
cluster_10.pdb ( medoid)	2.28803	15.7341	39.241	36