Project name: 2ffcae5267c9eda

Status: done

submitted: 2026-04-02 12:35:12, status changed: 2026-04-02 14:36:00

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence IGASWPDHATT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.3375 7.51926 19.4212 183
cluster_2.pdb ( medoid) 20.3088 6.89357 18.5935 140
cluster_3.pdb ( medoid) 19.0373 2.57389 12.2886 49
cluster_4.pdb ( medoid) 16.6116 7.16368 18.0905 119
cluster_5.pdb ( medoid) 15.0764 6.69922 21.4683 101
cluster_6.pdb ( medoid) 12.1819 8.78352 23.7108 107
cluster_7.pdb ( medoid) 12.1685 5.58819 27.8117 68
cluster_8.pdb ( medoid) 8.82388 8.83965 19.5186 78
cluster_9.pdb ( medoid) 8.72433 9.74286 31.0383 85
cluster_10.pdb ( medoid) 7.34814 9.52622 20.2367 70