CABS-dock: 30147caccfb9d1d

Project name: 30147caccfb9d1d

Status: done

submitted: 2026-02-20 12:47:56, status changed: 2026-02-20 15:26:26

Project settings

Protein sequence(s)	SPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF input pdb
Peptide sequence	EMFGTSSET
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.7863	4.02045	16.1941	168
cluster_2.pdb ( medoid)	32.2716	4.92694	13.1366	159
cluster_3.pdb ( medoid)	31.3585	3.76294	9.03543	118
cluster_4.pdb ( medoid)	18.1261	4.52387	23.3076	82
cluster_5.pdb ( medoid)	16.0251	4.49295	24.9875	72
cluster_6.pdb ( medoid)	13.8974	11.513	35.6066	160
cluster_7.pdb ( medoid)	7.9861	10.0174	33.2254	80
cluster_8.pdb ( medoid)	5.85802	10.7545	21.2239	63
cluster_9.pdb ( medoid)	5.01141	12.1722	30.5154	61
cluster_10.pdb ( medoid)	2.06422	17.9245	38.1143	37