Project name: 30147caccfb9d1d

Status: done

submitted: 2026-02-20 12:47:56, status changed: 2026-02-20 15:26:26

Project settings
Protein sequence(s) SPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF input pdb
Peptide sequence EMFGTSSET
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 41.7863 4.02045 16.1941 168
cluster_2.pdb ( medoid) 32.2716 4.92694 13.1366 159
cluster_3.pdb ( medoid) 31.3585 3.76294 9.03543 118
cluster_4.pdb ( medoid) 18.1261 4.52387 23.3076 82
cluster_5.pdb ( medoid) 16.0251 4.49295 24.9875 72
cluster_6.pdb ( medoid) 13.8974 11.513 35.6066 160
cluster_7.pdb ( medoid) 7.9861 10.0174 33.2254 80
cluster_8.pdb ( medoid) 5.85802 10.7545 21.2239 63
cluster_9.pdb ( medoid) 5.01141 12.1722 30.5154 61
cluster_10.pdb ( medoid) 2.06422 17.9245 38.1143 37