CABS-dock: 303e37a91364283

Project name: 303e37a91364283

Status: done

submitted: 2025-12-31 16:40:36, status changed: 2025-12-31 18:59:09

Project settings

Protein sequence(s)	RLRGAVTRCEDGQLFITMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYC input pdb
Peptide sequence	GYKLGVDCVPC
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	43.2277	2.61406	18.889	113
cluster_2.pdb ( medoid)	25.5325	9.43896	36.2523	241
cluster_3.pdb ( medoid)	11.8514	5.14705	18.3119	61
cluster_4.pdb ( medoid)	10.6815	10.6726	33.0316	114
cluster_5.pdb ( medoid)	10.6418	11.5582	32.1323	123
cluster_6.pdb ( medoid)	9.79497	6.53397	15.8311	64
cluster_7.pdb ( medoid)	8.17665	12.7191	32.9693	104
cluster_8.pdb ( medoid)	7.17214	13.1063	33.7129	94
cluster_9.pdb ( medoid)	5.70409	9.29157	30.7509	53
cluster_10.pdb ( medoid)	2.03879	16.1861	38.6201	33