Project name: 305ea63fdf1290b

Status: done

submitted: 2025-10-20 17:22:40, status changed: 2025-10-20 20:47:57

Project settings
Protein sequence(s) DLTVEKAADVTWEEEEAEQTGVSHNLMITVDDDGTMRIKDGGSGVLWDVPSPAELEEGVYRIKQQGIFGKTQVGVGVQKEGVFHTMWHVTRGAVLTHNGKRLEPNWASVKKDLISYGGGWRLSAQWQKGEEVQVIAVEPGKNPKNFQTMPGTFQTTTGEIGAIALDFKPGTSGSPIINREGKVVGLYGNGVVTKNGGYVSGIAQTNAE input pdb
Peptide sequence GRRSIALD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.6918 2.969 20.6214 103
cluster_2.pdb ( medoid) 24.8476 8.81371 34.981 219
cluster_3.pdb ( medoid) 23.1664 4.27343 30.3367 99
cluster_4.pdb ( medoid) 16.9799 5.12372 17.1937 87
cluster_5.pdb ( medoid) 16.5673 6.57921 28.9519 109
cluster_6.pdb ( medoid) 13.296 10.2287 32.6121 136
cluster_7.pdb ( medoid) 12.76 6.50472 25.1425 83
cluster_8.pdb ( medoid) 6.20398 5.31916 14.3459 33
cluster_9.pdb ( medoid) 5.0148 14.9557 29.8892 75
cluster_10.pdb ( medoid) 3.42611 16.3451 38.318 56