CABS-dock: 306ce755a49a911

Project name: 306ce755a49a911

Status: done

submitted: 2026-04-01 13:00:09, status changed: 2026-04-01 13:44:52

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	SPNTSDQSLMCT
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	66.175	1.51115	2.8227	100
cluster_2.pdb ( medoid)	30.5772	4.97102	18.7333	152
cluster_3.pdb ( medoid)	24.5836	8.1355	18.1818	200
cluster_4.pdb ( medoid)	19.7313	5.16946	21.181	102
cluster_5.pdb ( medoid)	14.6249	7.17954	22.6884	105
cluster_6.pdb ( medoid)	9.67298	12.8192	24.5443	124
cluster_7.pdb ( medoid)	5.47664	12.4164	22.7517	68
cluster_8.pdb ( medoid)	4.93678	9.52038	17.7652	47
cluster_9.pdb ( medoid)	4.44048	10.5844	20.5896	47
cluster_10.pdb ( medoid)	4.38253	12.5498	30.8291	55