Project name: 4OZ1

Status: done

submitted: 2026-03-19 19:51:09, status changed: 2026-03-20 01:30:16

Project settings
Protein sequence(s) VQPLATQCFQLSSNMFNPQTEEEVGWDTEIKDDVIEEECNKHGGVIHIYVDKNSSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSPLATQCFQLSSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIIYVDKNSAQQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSR input pdb
Peptide sequence KRKSRWDETP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.2394 5.67629 31.26 183
cluster_2.pdb ( medoid) 24.2625 4.78103 17.0332 116
cluster_3.pdb ( medoid) 23.7497 5.47374 23.8325 130
cluster_4.pdb ( medoid) 23.3069 5.14868 34.7238 120
cluster_5.pdb ( medoid) 22.1391 7.22703 32.3658 160
cluster_6.pdb ( medoid) 20.3264 5.11651 20.6263 104
cluster_7.pdb ( medoid) 8.69017 10.0113 29.2728 87
cluster_8.pdb ( medoid) 6.99944 6.42909 23.5848 45
cluster_9.pdb ( medoid) 3.36021 9.52322 26.281 32
cluster_10.pdb ( medoid) 1.98207 11.604 27.4282 23