CABS-dock: 30ab636abd857f8

Project name: 30ab636abd857f8

Status: done

submitted: 2026-05-01 02:48:37, status changed: 2026-05-01 08:36:41

Project settings

Protein sequence(s)	NLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGL input pdb
Peptide sequence	EGQAVAFR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.8223	5.69004	27.8241	164
cluster_2.pdb ( medoid)	22.9766	4.87453	23.896	112
cluster_3.pdb ( medoid)	16.5992	5.36171	21.8359	89
cluster_4.pdb ( medoid)	16.5177	10.1104	36.794	167
cluster_5.pdb ( medoid)	11.5807	6.9944	35.7063	81
cluster_6.pdb ( medoid)	11.1233	10.7881	35.9705	120
cluster_7.pdb ( medoid)	10.0494	11.742	41.6356	118
cluster_8.pdb ( medoid)	7.18368	4.31533	21.1441	31
cluster_9.pdb ( medoid)	5.52362	12.6729	39.5382	70
cluster_10.pdb ( medoid)	4.41017	10.8839	29.1645	48