Project name: 7RP8 200

Status: done

submitted: 2025-11-13 04:14:10, status changed: 2025-11-14 05:36:09

Project settings
Protein sequence(s) HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFDMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII input pdb
Peptide sequence KDSMEEY
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 53.0849 2.05331 10.2246 109
cluster_2.pdb ( medoid) 39.118 0.894728 3.96182 35
cluster_3.pdb ( medoid) 39.0281 1.35799 9.74037 53
cluster_4.pdb ( medoid) 29.0936 3.88401 31.8062 113
cluster_5.pdb ( medoid) 27.3563 8.55379 44.4396 234
cluster_6.pdb ( medoid) 18.654 2.19792 8.90096 41
cluster_7.pdb ( medoid) 17.4326 10.3828 44.1987 181
cluster_8.pdb ( medoid) 15.5719 6.93555 28.0463 108
cluster_9.pdb ( medoid) 7.92668 9.33556 33.4395 74
cluster_10.pdb ( medoid) 4.37009 11.8991 33.2772 52