CABS-dock: 1DEE:A-DVFLG

Project name: 1DEE:A-DVFLG

Status: done

submitted: 2025-10-08 12:45:38, status changed: 2025-10-08 15:34:42

Project settings

Protein sequence(s)	QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL input pdb
Peptide sequence	DVFLG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.5791	3.06021	17.8187	115
cluster_2.pdb ( medoid)	35.6996	2.99723	9.02877	107
cluster_3.pdb ( medoid)	27.2284	5.7293	27.144	156
cluster_4.pdb ( medoid)	24.5866	6.71098	34.5484	165
cluster_5.pdb ( medoid)	19.5523	4.19389	10.0464	82
cluster_6.pdb ( medoid)	14.5005	7.58592	32.6835	110
cluster_7.pdb ( medoid)	13.5245	4.88002	12.6612	66
cluster_8.pdb ( medoid)	7.83317	12.5109	32.8292	98
cluster_9.pdb ( medoid)	6.95707	10.2054	35.5296	71
cluster_10.pdb ( medoid)	6.31743	4.74877	10.1435	30