Project name: 1DEE:A-DVFLG

Status: done

submitted: 2025-10-08 12:45:38, status changed: 2025-10-08 15:34:42

Project settings
Protein sequence(s) QVQLVESGGGVVQPGKSLRLSCAASGFTFSGYGMHWVRQAPGKGLEWVALISYDESNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVKFYDPTAPNDYWGQGTLVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVAQGTNEHVVCKVQHPNGNKEKDVPL input pdb
Peptide sequence DVFLG
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.5791 3.06021 17.8187 115
cluster_2.pdb ( medoid) 35.6996 2.99723 9.02877 107
cluster_3.pdb ( medoid) 27.2284 5.7293 27.144 156
cluster_4.pdb ( medoid) 24.5866 6.71098 34.5484 165
cluster_5.pdb ( medoid) 19.5523 4.19389 10.0464 82
cluster_6.pdb ( medoid) 14.5005 7.58592 32.6835 110
cluster_7.pdb ( medoid) 13.5245 4.88002 12.6612 66
cluster_8.pdb ( medoid) 7.83317 12.5109 32.8292 98
cluster_9.pdb ( medoid) 6.95707 10.2054 35.5296 71
cluster_10.pdb ( medoid) 6.31743 4.74877 10.1435 30